Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3879832..3880352 Replicon chromosome
Accession NZ_CP124351
Organism Escherichia coli strain AVS0362

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QJP84_RS19060 Protein ID WP_001160964.1
Coordinates 3880068..3880352 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP84_RS19055 Protein ID WP_000125566.1
Coordinates 3879832..3880065 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP84_RS19030 (3874905) 3874905..3875192 + 288 WP_000203744.1 ferredoxin-like protein FixX -
QJP84_RS19035 (3875251) 3875251..3876582 + 1332 WP_001183209.1 MFS transporter -
QJP84_RS19040 (3876690) 3876690..3877220 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP84_RS19045 (3877213) 3877213..3879075 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
QJP84_RS19050 (3879267) 3879267..3879746 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP84_RS19055 (3879832) 3879832..3880065 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP84_RS19060 (3880068) 3880068..3880352 + 285 WP_001160964.1 CcdB family protein Toxin
QJP84_RS19065 (3880379) 3880379..3881227 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP84_RS19070 (3881234) 3881234..3881611 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP84_RS19075 (3881614) 3881614..3882435 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP84_RS19080 (3882432) 3882432..3883421 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP84_RS19085 (3883421) 3883421..3884707 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T279718 WP_001160964.1 NZ_CP124351:3880068-3880352 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT279718 WP_000125566.1 NZ_CP124351:3879832-3880065 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References