Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 866223..867054 Replicon chromosome
Accession NZ_CP124351
Organism Escherichia coli strain AVS0362

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP84_RS04580 Protein ID WP_000854815.1
Coordinates 866680..867054 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP84_RS04575 Protein ID WP_001280918.1
Coordinates 866223..866591 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP84_RS04530 (861312) 861312..862058 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP84_RS04535 (862141) 862141..862491 + 351 Protein_895 hypothetical protein -
QJP84_RS04540 (862507) 862507..862917 + 411 WP_000846703.1 hypothetical protein -
QJP84_RS04545 (863138) 863138..863956 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJP84_RS04550 (863956) 863956..864201 + 246 WP_001164966.1 hypothetical protein -
QJP84_RS04555 (864295) 864295..864768 + 474 WP_001542276.1 antirestriction protein -
QJP84_RS04560 (864784) 864784..865260 + 477 WP_001186200.1 RadC family protein -
QJP84_RS04565 (865323) 865323..865544 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP84_RS04570 (865563) 865563..866207 + 645 WP_000086752.1 hypothetical protein -
QJP84_RS04575 (866223) 866223..866591 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP84_RS04580 (866680) 866680..867054 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP84_RS04585 (867051) 867051..867245 + 195 WP_000988600.1 DUF5983 family protein -
QJP84_RS04590 (867291) 867291..867371 + 81 Protein_906 hypothetical protein -
QJP84_RS04595 (867660) 867660..867740 - 81 WP_023441679.1 hypothetical protein -
QJP84_RS04600 (867719) 867719..868042 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP84_RS04605 (868143) 868143..868472 - 330 WP_000450409.1 DUF496 family protein -
QJP84_RS04610 (868644) 868644..869702 - 1059 WP_001200889.1 FUSC family protein -
QJP84_RS04615 (869900) 869900..870373 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP84_RS04620 (870492) 870492..871658 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T279705 WP_000854815.1 NZ_CP124351:866680-867054 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT279705 WP_001280918.1 NZ_CP124351:866223-866591 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References