Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3686377..3687212 | Replicon | chromosome |
| Accession | NZ_CP124349 | ||
| Organism | Escherichia coli strain AVS0453 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QJP64_RS18135 | Protein ID | WP_000854759.1 |
| Coordinates | 3686835..3687212 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QJP64_RS18130 | Protein ID | WP_001295723.1 |
| Coordinates | 3686377..3686745 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP64_RS18105 (3683492) | 3683492..3683687 | + | 196 | Protein_3542 | DUF905 family protein | - |
| QJP64_RS18110 (3683805) | 3683805..3684623 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| QJP64_RS18115 (3684965) | 3684965..3685438 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| QJP64_RS18120 (3685454) | 3685454..3685930 | + | 477 | WP_001186775.1 | RadC family protein | - |
| QJP64_RS18125 (3685993) | 3685993..3686214 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP64_RS18130 (3686377) | 3686377..3686745 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP64_RS18135 (3686835) | 3686835..3687212 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QJP64_RS18140 (3687209) | 3687209..3687697 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP64_RS18145 (3687714) | 3687714..3687890 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP64_RS18150 (3687996) | 3687996..3688145 | + | 150 | Protein_3551 | hypothetical protein | - |
| QJP64_RS18155 (3688604) | 3688604..3690145 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QJP64_RS18160 (3690160) | 3690160..3690906 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP64_RS18165 (3691098) | 3691098..3691274 | + | 177 | Protein_3554 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3672682..3701444 | 28762 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T279681 WP_000854759.1 NZ_CP124349:3686835-3687212 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT279681 WP_001295723.1 NZ_CP124349:3686377-3686745 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |