Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2035030..2035864 | Replicon | chromosome |
| Accession | NZ_CP124349 | ||
| Organism | Escherichia coli strain AVS0453 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | QJP64_RS10185 | Protein ID | WP_000854690.1 |
| Coordinates | 2035487..2035864 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | QJP64_RS10180 | Protein ID | WP_001305076.1 |
| Coordinates | 2035030..2035398 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP64_RS10140 (2030112) | 2030112..2031239 | + | 1128 | Protein_1994 | hypothetical protein | - |
| QJP64_RS10145 (2031315) | 2031315..2031770 | + | 456 | WP_000581502.1 | IrmA family protein | - |
| QJP64_RS10150 (2031849) | 2031849..2032082 | + | 234 | WP_000902034.1 | DUF905 family protein | - |
| QJP64_RS10155 (2032183) | 2032183..2033001 | + | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJP64_RS10160 (2033056) | 2033056..2033541 | + | 486 | WP_000849565.1 | antirestriction protein | - |
| QJP64_RS10165 (2033557) | 2033557..2034033 | + | 477 | WP_001186726.1 | RadC family protein | - |
| QJP64_RS10170 (2034096) | 2034096..2034317 | + | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| QJP64_RS10175 (2034336) | 2034336..2034980 | + | 645 | WP_000094916.1 | hypothetical protein | - |
| QJP64_RS10180 (2035030) | 2035030..2035398 | + | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP64_RS10185 (2035487) | 2035487..2035864 | + | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| QJP64_RS10190 (2035861) | 2035861..2036349 | + | 489 | WP_000761699.1 | DUF5983 family protein | - |
| QJP64_RS10195 (2036366) | 2036366..2036563 | + | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| QJP64_RS10200 (2036648) | 2036648..2037493 | + | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| QJP64_RS10205 (2037562) | 2037562..2037957 | + | 396 | WP_000208384.1 | DUF6088 family protein | - |
| QJP64_RS10210 (2037950) | 2037950..2038883 | + | 934 | Protein_2008 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJP64_RS10215 (2039300) | 2039300..2039470 | + | 171 | Protein_2009 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2039315..2039470 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T279673 WP_000854690.1 NZ_CP124349:2035487-2035864 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT279673 WP_001305076.1 NZ_CP124349:2035030-2035398 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|