Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4224994..4225828 | Replicon | chromosome |
| Accession | NZ_CP124347 | ||
| Organism | Escherichia coli strain AVS0283 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QJP56_RS20655 | Protein ID | WP_000854770.1 |
| Coordinates | 4224994..4225371 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QJP56_RS20660 | Protein ID | WP_001280950.1 |
| Coordinates | 4225460..4225828 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP56_RS20630 (4221105) | 4221105..4222727 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QJP56_RS20635 (4223518) | 4223518..4223694 | - | 177 | Protein_4048 | helix-turn-helix domain-containing protein | - |
| QJP56_RS20640 (4224061) | 4224061..4224210 | - | 150 | Protein_4049 | hypothetical protein | - |
| QJP56_RS20645 (4224316) | 4224316..4224492 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP56_RS20650 (4224509) | 4224509..4224997 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP56_RS20655 (4224994) | 4224994..4225371 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QJP56_RS20660 (4225460) | 4225460..4225828 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP56_RS20665 (4225991) | 4225991..4226212 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QJP56_RS20670 (4226275) | 4226275..4226751 | - | 477 | WP_001186779.1 | RadC family protein | - |
| QJP56_RS20675 (4226767) | 4226767..4227231 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| QJP56_RS20680 (4227573) | 4227573..4228391 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| QJP56_RS20685 (4228509) | 4228509..4228704 | - | 196 | Protein_4058 | DUF905 family protein | - |
| QJP56_RS20690 (4228775) | 4228775..4230676 | - | 1902 | Protein_4059 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4213348..4253557 | 40209 | |
| - | inside | Genomic island | - | - | 4216774..4253557 | 36783 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T279662 WP_000854770.1 NZ_CP124347:c4225371-4224994 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT279662 WP_001280950.1 NZ_CP124347:c4225828-4225460 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |