Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4044663..4045213 Replicon chromosome
Accession NZ_CP124347
Organism Escherichia coli strain AVS0283

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP56_RS19755 Protein ID WP_001160966.1
Coordinates 4044663..4044977 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP56_RS19760 Protein ID WP_000125566.1
Coordinates 4044980..4045213 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP56_RS19730 (4040338) 4040338..4041624 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP56_RS19735 (4041624) 4041624..4042613 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP56_RS19740 (4042610) 4042610..4043431 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP56_RS19745 (4043434) 4043434..4043811 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP56_RS19750 (4043818) 4043818..4044666 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP56_RS19755 (4044663) 4044663..4044977 - 315 WP_001160966.1 CcdB family protein Toxin
QJP56_RS19760 (4044980) 4044980..4045213 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP56_RS19765 (4045299) 4045299..4045778 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP56_RS19770 (4045970) 4045970..4047832 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP56_RS19775 (4047825) 4047825..4048355 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP56_RS19780 (4048463) 4048463..4049794 - 1332 WP_001183207.1 MFS transporter -
QJP56_RS19785 (4049853) 4049853..4050140 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T279660 WP_001160966.1 NZ_CP124347:c4044977-4044663 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT279660 WP_000125566.1 NZ_CP124347:c4045213-4044980 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References