Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3631104..3631722 | Replicon | chromosome |
| Accession | NZ_CP124347 | ||
| Organism | Escherichia coli strain AVS0283 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QJP56_RS17815 | Protein ID | WP_001291435.1 |
| Coordinates | 3631504..3631722 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QJP56_RS17810 | Protein ID | WP_000344800.1 |
| Coordinates | 3631104..3631478 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP56_RS17800 (3626193) | 3626193..3627386 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QJP56_RS17805 (3627409) | 3627409..3630558 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| QJP56_RS17810 (3631104) | 3631104..3631478 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QJP56_RS17815 (3631504) | 3631504..3631722 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QJP56_RS17820 (3631895) | 3631895..3632446 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QJP56_RS17825 (3632562) | 3632562..3633032 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QJP56_RS17830 (3633196) | 3633196..3634746 | + | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QJP56_RS17835 (3634788) | 3634788..3635141 | - | 354 | WP_000878147.1 | DUF1428 family protein | - |
| QJP56_RS17845 (3635520) | 3635520..3635831 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| QJP56_RS17850 (3635862) | 3635862..3636434 | - | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T279658 WP_001291435.1 NZ_CP124347:3631504-3631722 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT279658 WP_000344800.1 NZ_CP124347:3631104-3631478 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |