Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4046211..4046761 Replicon chromosome
Accession NZ_CP124345
Organism Escherichia coli strain AVS0530

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP77_RS19745 Protein ID WP_001160966.1
Coordinates 4046211..4046525 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP77_RS19750 Protein ID WP_000125566.1
Coordinates 4046528..4046761 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP77_RS19720 (4041886) 4041886..4043172 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP77_RS19725 (4043172) 4043172..4044161 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP77_RS19730 (4044158) 4044158..4044979 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP77_RS19735 (4044982) 4044982..4045359 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP77_RS19740 (4045366) 4045366..4046214 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP77_RS19745 (4046211) 4046211..4046525 - 315 WP_001160966.1 CcdB family protein Toxin
QJP77_RS19750 (4046528) 4046528..4046761 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP77_RS19755 (4046847) 4046847..4047326 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP77_RS19760 (4047518) 4047518..4049380 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP77_RS19765 (4049373) 4049373..4049903 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP77_RS19770 (4050011) 4050011..4051342 - 1332 WP_001183207.1 MFS transporter -
QJP77_RS19775 (4051401) 4051401..4051688 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T279638 WP_001160966.1 NZ_CP124345:c4046525-4046211 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT279638 WP_000125566.1 NZ_CP124345:c4046761-4046528 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References