Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2024915..2025746 Replicon chromosome
Accession NZ_CP124345
Organism Escherichia coli strain AVS0530

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP77_RS09665 Protein ID WP_000854814.1
Coordinates 2024915..2025289 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP77_RS09670 Protein ID WP_001546021.1
Coordinates 2025378..2025746 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP77_RS09630 (2020910) 2020910..2021239 + 330 WP_000450409.1 DUF496 family protein -
QJP77_RS09635 (2021340) 2021340..2021663 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP77_RS09640 (2021642) 2021642..2021722 + 81 WP_023441679.1 hypothetical protein -
QJP77_RS09645 (2021933) 2021933..2023474 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJP77_RS09650 (2023489) 2023489..2024235 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP77_RS09655 (2024598) 2024598..2024678 - 81 Protein_1897 hypothetical protein -
QJP77_RS09660 (2024724) 2024724..2024918 - 195 WP_000988601.1 DUF5983 family protein -
QJP77_RS09665 (2024915) 2024915..2025289 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP77_RS09670 (2025378) 2025378..2025746 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP77_RS09675 (2025826) 2025826..2026047 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJP77_RS09680 (2026110) 2026110..2026586 - 477 WP_001186773.1 RadC family protein -
QJP77_RS09685 (2026602) 2026602..2027075 - 474 WP_001385393.1 antirestriction protein -
QJP77_RS09690 (2027338) 2027338..2028159 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJP77_RS09695 (2028380) 2028380..2028790 - 411 WP_000846704.1 hypothetical protein -
QJP77_RS09700 (2028806) 2028806..2029483 - 678 WP_001362823.1 hypothetical protein -
QJP77_RS09705 (2029619) 2029619..2030689 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T279628 WP_000854814.1 NZ_CP124345:c2025289-2024915 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT279628 WP_001546021.1 NZ_CP124345:c2025746-2025378 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References