Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4538472..4539307 | Replicon | chromosome |
| Accession | NZ_CP124343 | ||
| Organism | Escherichia coli strain AVS0533 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q8VR61 |
| Locus tag | QJP85_RS22170 | Protein ID | WP_000854747.1 |
| Coordinates | 4538930..4539307 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A6A0PK89 |
| Locus tag | QJP85_RS22165 | Protein ID | WP_024186867.1 |
| Coordinates | 4538472..4538840 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP85_RS22130 (4534384) | 4534384..4535064 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| QJP85_RS22135 (4535212) | 4535212..4535889 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| QJP85_RS22140 (4535895) | 4535895..4536128 | + | 234 | WP_001278280.1 | DUF905 family protein | - |
| QJP85_RS22145 (4536218) | 4536218..4537036 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
| QJP85_RS22150 (4537127) | 4537127..4537612 | + | 486 | WP_001588934.1 | antirestriction protein | - |
| QJP85_RS22155 (4537627) | 4537627..4538103 | + | 477 | WP_001588933.1 | RadC family protein | - |
| QJP85_RS22160 (4538172) | 4538172..4538393 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QJP85_RS22165 (4538472) | 4538472..4538840 | + | 369 | WP_024186867.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP85_RS22170 (4538930) | 4538930..4539307 | + | 378 | WP_000854747.1 | TA system toxin CbtA family protein | Toxin |
| QJP85_RS22175 (4539304) | 4539304..4539792 | + | 489 | WP_000761667.1 | DUF5983 family protein | - |
| QJP85_RS22180 (4539804) | 4539804..4540001 | + | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
| QJP85_RS22185 (4540086) | 4540086..4540940 | + | 855 | WP_001588930.1 | DUF4942 domain-containing protein | - |
| QJP85_RS22190 (4541258) | 4541258..4541417 | + | 160 | Protein_4354 | integrase | - |
| QJP85_RS22195 (4541677) | 4541677..4543215 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4525788..4566711 | 40923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14095.03 Da Isoelectric Point: 6.8524
>T279619 WP_000854747.1 NZ_CP124343:4538930-4539307 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13555.35 Da Isoelectric Point: 6.4745
>AT279619 WP_024186867.1 NZ_CP124343:4538472-4538840 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2VFZ1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6A0PK89 |