Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4046335..4046885 Replicon chromosome
Accession NZ_CP124343
Organism Escherichia coli strain AVS0533

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP85_RS19760 Protein ID WP_001160966.1
Coordinates 4046335..4046649 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP85_RS19765 Protein ID WP_000125566.1
Coordinates 4046652..4046885 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP85_RS19735 (4042010) 4042010..4043296 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP85_RS19740 (4043296) 4043296..4044285 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP85_RS19745 (4044282) 4044282..4045103 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP85_RS19750 (4045106) 4045106..4045483 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP85_RS19755 (4045490) 4045490..4046338 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP85_RS19760 (4046335) 4046335..4046649 - 315 WP_001160966.1 CcdB family protein Toxin
QJP85_RS19765 (4046652) 4046652..4046885 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP85_RS19770 (4046971) 4046971..4047450 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP85_RS19775 (4047642) 4047642..4049504 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP85_RS19780 (4049497) 4049497..4050027 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP85_RS19785 (4050135) 4050135..4051466 - 1332 WP_001183207.1 MFS transporter -
QJP85_RS19790 (4051525) 4051525..4051812 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T279616 WP_001160966.1 NZ_CP124343:c4046649-4046335 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT279616 WP_000125566.1 NZ_CP124343:c4046885-4046652 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References