Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3632778..3633396 | Replicon | chromosome |
| Accession | NZ_CP124343 | ||
| Organism | Escherichia coli strain AVS0533 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QJP85_RS17820 | Protein ID | WP_001291435.1 |
| Coordinates | 3633178..3633396 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QJP85_RS17815 | Protein ID | WP_000344800.1 |
| Coordinates | 3632778..3633152 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP85_RS17805 (3627867) | 3627867..3629060 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QJP85_RS17810 (3629083) | 3629083..3632232 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| QJP85_RS17815 (3632778) | 3632778..3633152 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QJP85_RS17820 (3633178) | 3633178..3633396 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QJP85_RS17825 (3633569) | 3633569..3634120 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QJP85_RS17830 (3634236) | 3634236..3634706 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QJP85_RS17835 (3634870) | 3634870..3636420 | + | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QJP85_RS17840 (3636462) | 3636462..3636815 | - | 354 | WP_000878147.1 | DUF1428 family protein | - |
| QJP85_RS17850 (3637194) | 3637194..3637505 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| QJP85_RS17855 (3637536) | 3637536..3638108 | - | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T279614 WP_001291435.1 NZ_CP124343:3633178-3633396 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT279614 WP_000344800.1 NZ_CP124343:3632778-3633152 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |