Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4507902..4508737 | Replicon | chromosome |
| Accession | NZ_CP124341 | ||
| Organism | Escherichia coli strain AVS0710 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q8VR61 |
| Locus tag | QJB06_RS22000 | Protein ID | WP_000854747.1 |
| Coordinates | 4508360..4508737 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A6A0PK89 |
| Locus tag | QJB06_RS21995 | Protein ID | WP_024186867.1 |
| Coordinates | 4507902..4508270 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB06_RS21960 (4503814) | 4503814..4504494 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| QJB06_RS21965 (4504642) | 4504642..4505319 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| QJB06_RS21970 (4505325) | 4505325..4505558 | + | 234 | WP_001278280.1 | DUF905 family protein | - |
| QJB06_RS21975 (4505648) | 4505648..4506466 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
| QJB06_RS21980 (4506557) | 4506557..4507042 | + | 486 | WP_001588934.1 | antirestriction protein | - |
| QJB06_RS21985 (4507057) | 4507057..4507533 | + | 477 | WP_001588933.1 | RadC family protein | - |
| QJB06_RS21990 (4507602) | 4507602..4507823 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QJB06_RS21995 (4507902) | 4507902..4508270 | + | 369 | WP_024186867.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJB06_RS22000 (4508360) | 4508360..4508737 | + | 378 | WP_000854747.1 | TA system toxin CbtA family protein | Toxin |
| QJB06_RS22005 (4508734) | 4508734..4509222 | + | 489 | WP_000761667.1 | DUF5983 family protein | - |
| QJB06_RS22010 (4509234) | 4509234..4509431 | + | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
| QJB06_RS22015 (4509516) | 4509516..4510370 | + | 855 | WP_001588930.1 | DUF4942 domain-containing protein | - |
| QJB06_RS22020 (4510688) | 4510688..4510847 | + | 160 | Protein_4323 | integrase | - |
| QJB06_RS22025 (4511107) | 4511107..4512645 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4495218..4536141 | 40923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14095.03 Da Isoelectric Point: 6.8524
>T279597 WP_000854747.1 NZ_CP124341:4508360-4508737 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13555.35 Da Isoelectric Point: 6.4745
>AT279597 WP_024186867.1 NZ_CP124341:4507902-4508270 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2VFZ1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6A0PK89 |