Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4196096..4196930 | Replicon | chromosome |
| Accession | NZ_CP124341 | ||
| Organism | Escherichia coli strain AVS0710 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QJB06_RS20490 | Protein ID | WP_000854770.1 |
| Coordinates | 4196096..4196473 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QJB06_RS20495 | Protein ID | WP_001280950.1 |
| Coordinates | 4196562..4196930 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB06_RS20465 (4192207) | 4192207..4193829 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QJB06_RS20470 (4194620) | 4194620..4194796 | - | 177 | Protein_4018 | helix-turn-helix domain-containing protein | - |
| QJB06_RS20475 (4195163) | 4195163..4195312 | - | 150 | Protein_4019 | hypothetical protein | - |
| QJB06_RS20480 (4195418) | 4195418..4195594 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJB06_RS20485 (4195611) | 4195611..4196099 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJB06_RS20490 (4196096) | 4196096..4196473 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QJB06_RS20495 (4196562) | 4196562..4196930 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJB06_RS20500 (4197093) | 4197093..4197314 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QJB06_RS20505 (4197377) | 4197377..4197853 | - | 477 | WP_001186779.1 | RadC family protein | - |
| QJB06_RS20510 (4197869) | 4197869..4198333 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| QJB06_RS20515 (4198675) | 4198675..4199493 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| QJB06_RS20520 (4199611) | 4199611..4199806 | - | 196 | Protein_4028 | DUF905 family protein | - |
| QJB06_RS20525 (4199877) | 4199877..4201778 | - | 1902 | Protein_4029 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4184450..4224659 | 40209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T279596 WP_000854770.1 NZ_CP124341:c4196473-4196096 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT279596 WP_001280950.1 NZ_CP124341:c4196930-4196562 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |