Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1996538..1997369 | Replicon | chromosome |
| Accession | NZ_CP124341 | ||
| Organism | Escherichia coli strain AVS0710 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | QJB06_RS09535 | Protein ID | WP_000854814.1 |
| Coordinates | 1996538..1996912 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A641DSP2 |
| Locus tag | QJB06_RS09540 | Protein ID | WP_001546021.1 |
| Coordinates | 1997001..1997369 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB06_RS09500 (1992533) | 1992533..1992862 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| QJB06_RS09505 (1992963) | 1992963..1993286 | - | 324 | WP_223216378.1 | EutP/PduV family microcompartment system protein | - |
| QJB06_RS09510 (1993265) | 1993265..1993345 | + | 81 | WP_023441679.1 | hypothetical protein | - |
| QJB06_RS09515 (1993556) | 1993556..1995097 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QJB06_RS09520 (1995112) | 1995112..1995858 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJB06_RS09525 (1996221) | 1996221..1996301 | - | 81 | Protein_1871 | hypothetical protein | - |
| QJB06_RS09530 (1996347) | 1996347..1996541 | - | 195 | WP_000988601.1 | DUF5983 family protein | - |
| QJB06_RS09535 (1996538) | 1996538..1996912 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QJB06_RS09540 (1997001) | 1997001..1997369 | - | 369 | WP_001546021.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJB06_RS09545 (1997449) | 1997449..1997670 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QJB06_RS09550 (1997733) | 1997733..1998209 | - | 477 | WP_001186773.1 | RadC family protein | - |
| QJB06_RS09555 (1998225) | 1998225..1998698 | - | 474 | WP_001385393.1 | antirestriction protein | - |
| QJB06_RS09560 (1998961) | 1998961..1999782 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
| QJB06_RS09565 (2000003) | 2000003..2000413 | - | 411 | WP_000846704.1 | hypothetical protein | - |
| QJB06_RS09570 (2000429) | 2000429..2001106 | - | 678 | WP_001362823.1 | hypothetical protein | - |
| QJB06_RS09575 (2001242) | 2001242..2002312 | - | 1071 | WP_000102631.1 | patatin-like phospholipase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T279584 WP_000854814.1 NZ_CP124341:c1996912-1996538 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13607.47 Da Isoelectric Point: 6.3139
>AT279584 WP_001546021.1 NZ_CP124341:c1997369-1997001 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A641DSP2 |