Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1996538..1997369 Replicon chromosome
Accession NZ_CP124341
Organism Escherichia coli strain AVS0710

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJB06_RS09535 Protein ID WP_000854814.1
Coordinates 1996538..1996912 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJB06_RS09540 Protein ID WP_001546021.1
Coordinates 1997001..1997369 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB06_RS09500 (1992533) 1992533..1992862 + 330 WP_000450409.1 DUF496 family protein -
QJB06_RS09505 (1992963) 1992963..1993286 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJB06_RS09510 (1993265) 1993265..1993345 + 81 WP_023441679.1 hypothetical protein -
QJB06_RS09515 (1993556) 1993556..1995097 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJB06_RS09520 (1995112) 1995112..1995858 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJB06_RS09525 (1996221) 1996221..1996301 - 81 Protein_1871 hypothetical protein -
QJB06_RS09530 (1996347) 1996347..1996541 - 195 WP_000988601.1 DUF5983 family protein -
QJB06_RS09535 (1996538) 1996538..1996912 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJB06_RS09540 (1997001) 1997001..1997369 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJB06_RS09545 (1997449) 1997449..1997670 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJB06_RS09550 (1997733) 1997733..1998209 - 477 WP_001186773.1 RadC family protein -
QJB06_RS09555 (1998225) 1998225..1998698 - 474 WP_001385393.1 antirestriction protein -
QJB06_RS09560 (1998961) 1998961..1999782 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJB06_RS09565 (2000003) 2000003..2000413 - 411 WP_000846704.1 hypothetical protein -
QJB06_RS09570 (2000429) 2000429..2001106 - 678 WP_001362823.1 hypothetical protein -
QJB06_RS09575 (2001242) 2001242..2002312 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T279584 WP_000854814.1 NZ_CP124341:c1996912-1996538 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT279584 WP_001546021.1 NZ_CP124341:c1997369-1997001 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References