Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4045971..4046521 Replicon chromosome
Accession NZ_CP124339
Organism Escherichia coli strain AVS0713

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP93_RS19745 Protein ID WP_001160966.1
Coordinates 4045971..4046285 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP93_RS19750 Protein ID WP_000125566.1
Coordinates 4046288..4046521 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP93_RS19720 (4041646) 4041646..4042932 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP93_RS19725 (4042932) 4042932..4043921 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP93_RS19730 (4043918) 4043918..4044739 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP93_RS19735 (4044742) 4044742..4045119 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP93_RS19740 (4045126) 4045126..4045974 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP93_RS19745 (4045971) 4045971..4046285 - 315 WP_001160966.1 CcdB family protein Toxin
QJP93_RS19750 (4046288) 4046288..4046521 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP93_RS19755 (4046607) 4046607..4047086 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP93_RS19760 (4047278) 4047278..4049140 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP93_RS19765 (4049133) 4049133..4049663 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP93_RS19770 (4049771) 4049771..4051102 - 1332 WP_001183207.1 MFS transporter -
QJP93_RS19775 (4051161) 4051161..4051448 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T279572 WP_001160966.1 NZ_CP124339:c4046285-4045971 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT279572 WP_000125566.1 NZ_CP124339:c4046521-4046288 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References