Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 290779..291579 | Replicon | chromosome |
Accession | NZ_CP124339 | ||
Organism | Escherichia coli strain AVS0713 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4T503 |
Locus tag | QJP93_RS01350 | Protein ID | WP_000342452.1 |
Coordinates | 291052..291579 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4T504 |
Locus tag | QJP93_RS01345 | Protein ID | WP_001277107.1 |
Coordinates | 290779..291045 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP93_RS01325 (286438) | 286438..287106 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
QJP93_RS01330 (287099) | 287099..288157 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
QJP93_RS01335 (288402) | 288402..289256 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
QJP93_RS01340 (289527) | 289527..290630 | + | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
QJP93_RS01345 (290779) | 290779..291045 | + | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
QJP93_RS01350 (291052) | 291052..291579 | + | 528 | WP_000342452.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
QJP93_RS01355 (291576) | 291576..291959 | - | 384 | WP_000778796.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
QJP93_RS01360 (292382) | 292382..293491 | + | 1110 | WP_001296485.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
QJP93_RS01365 (293539) | 293539..294465 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
QJP93_RS01370 (294462) | 294462..295739 | + | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
QJP93_RS01375 (295736) | 295736..296503 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.57 Da Isoelectric Point: 6.6348
>T279556 WP_000342452.1 NZ_CP124339:291052-291579 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061K5K9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061YQ57 |