Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4519455..4520290 | Replicon | chromosome |
| Accession | NZ_CP124337 | ||
| Organism | Escherichia coli strain AVS0971 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q8VR61 |
| Locus tag | QJP90_RS22040 | Protein ID | WP_000854747.1 |
| Coordinates | 4519913..4520290 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A6A0PK89 |
| Locus tag | QJP90_RS22035 | Protein ID | WP_024186867.1 |
| Coordinates | 4519455..4519823 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP90_RS22000 (4515367) | 4515367..4516047 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| QJP90_RS22005 (4516195) | 4516195..4516872 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| QJP90_RS22010 (4516878) | 4516878..4517111 | + | 234 | WP_001278280.1 | DUF905 family protein | - |
| QJP90_RS22015 (4517201) | 4517201..4518019 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
| QJP90_RS22020 (4518110) | 4518110..4518595 | + | 486 | WP_001588934.1 | antirestriction protein | - |
| QJP90_RS22025 (4518610) | 4518610..4519086 | + | 477 | WP_001588933.1 | RadC family protein | - |
| QJP90_RS22030 (4519155) | 4519155..4519376 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QJP90_RS22035 (4519455) | 4519455..4519823 | + | 369 | WP_024186867.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP90_RS22040 (4519913) | 4519913..4520290 | + | 378 | WP_000854747.1 | TA system toxin CbtA family protein | Toxin |
| QJP90_RS22045 (4520287) | 4520287..4520775 | + | 489 | WP_000761667.1 | DUF5983 family protein | - |
| QJP90_RS22050 (4520787) | 4520787..4520984 | + | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
| QJP90_RS22055 (4521069) | 4521069..4521923 | + | 855 | WP_001588930.1 | DUF4942 domain-containing protein | - |
| QJP90_RS22060 (4522241) | 4522241..4522400 | + | 160 | Protein_4330 | integrase | - |
| QJP90_RS22065 (4522660) | 4522660..4524198 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4506771..4547694 | 40923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14095.03 Da Isoelectric Point: 6.8524
>T279553 WP_000854747.1 NZ_CP124337:4519913-4520290 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13555.35 Da Isoelectric Point: 6.4745
>AT279553 WP_024186867.1 NZ_CP124337:4519455-4519823 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2VFZ1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6A0PK89 |