Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4207916..4208750 | Replicon | chromosome |
| Accession | NZ_CP124337 | ||
| Organism | Escherichia coli strain AVS0971 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QJP90_RS20535 | Protein ID | WP_000854770.1 |
| Coordinates | 4207916..4208293 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QJP90_RS20540 | Protein ID | WP_001280950.1 |
| Coordinates | 4208382..4208750 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP90_RS20510 (4204027) | 4204027..4205649 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QJP90_RS20515 (4206440) | 4206440..4206616 | - | 177 | Protein_4025 | helix-turn-helix domain-containing protein | - |
| QJP90_RS20520 (4206983) | 4206983..4207132 | - | 150 | Protein_4026 | hypothetical protein | - |
| QJP90_RS20525 (4207238) | 4207238..4207414 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP90_RS20530 (4207431) | 4207431..4207919 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP90_RS20535 (4207916) | 4207916..4208293 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QJP90_RS20540 (4208382) | 4208382..4208750 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP90_RS20545 (4208913) | 4208913..4209134 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QJP90_RS20550 (4209197) | 4209197..4209673 | - | 477 | WP_001186779.1 | RadC family protein | - |
| QJP90_RS20555 (4209689) | 4209689..4210153 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| QJP90_RS20560 (4210495) | 4210495..4211313 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| QJP90_RS20565 (4211431) | 4211431..4211626 | - | 196 | Protein_4035 | DUF905 family protein | - |
| QJP90_RS20570 (4211697) | 4211697..4213598 | - | 1902 | Protein_4036 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4196270..4236479 | 40209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T279552 WP_000854770.1 NZ_CP124337:c4208293-4207916 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT279552 WP_001280950.1 NZ_CP124337:c4208750-4208382 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |