Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4027585..4028135 Replicon chromosome
Accession NZ_CP124337
Organism Escherichia coli strain AVS0971

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP90_RS19635 Protein ID WP_001160966.1
Coordinates 4027585..4027899 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP90_RS19640 Protein ID WP_000125566.1
Coordinates 4027902..4028135 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP90_RS19610 (4023260) 4023260..4024546 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP90_RS19615 (4024546) 4024546..4025535 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP90_RS19620 (4025532) 4025532..4026353 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP90_RS19625 (4026356) 4026356..4026733 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP90_RS19630 (4026740) 4026740..4027588 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP90_RS19635 (4027585) 4027585..4027899 - 315 WP_001160966.1 CcdB family protein Toxin
QJP90_RS19640 (4027902) 4027902..4028135 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP90_RS19645 (4028221) 4028221..4028700 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP90_RS19650 (4028892) 4028892..4030754 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP90_RS19655 (4030747) 4030747..4031277 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP90_RS19660 (4031385) 4031385..4032716 - 1332 WP_001183207.1 MFS transporter -
QJP90_RS19665 (4032775) 4032775..4033062 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T279550 WP_001160966.1 NZ_CP124337:c4027899-4027585 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT279550 WP_000125566.1 NZ_CP124337:c4028135-4027902 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References