Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2001604..2002435 Replicon chromosome
Accession NZ_CP124337
Organism Escherichia coli strain AVS0971

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP90_RS09545 Protein ID WP_000854814.1
Coordinates 2001604..2001978 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0H0EA76
Locus tag QJP90_RS09550 Protein ID WP_001285592.1
Coordinates 2002067..2002435 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP90_RS09510 (1997599) 1997599..1997928 + 330 WP_000450409.1 DUF496 family protein -
QJP90_RS09515 (1998029) 1998029..1998352 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP90_RS09520 (1998331) 1998331..1998411 + 81 WP_023441679.1 hypothetical protein -
QJP90_RS09525 (1998622) 1998622..2000163 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJP90_RS09530 (2000178) 2000178..2000924 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP90_RS09535 (2001287) 2001287..2001367 - 81 Protein_1871 hypothetical protein -
QJP90_RS09540 (2001413) 2001413..2001607 - 195 WP_000988601.1 DUF5983 family protein -
QJP90_RS09545 (2001604) 2001604..2001978 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP90_RS09550 (2002067) 2002067..2002435 - 369 WP_001285592.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP90_RS09555 (2002515) 2002515..2002736 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJP90_RS09560 (2002799) 2002799..2003275 - 477 WP_001186773.1 RadC family protein -
QJP90_RS09565 (2003291) 2003291..2003764 - 474 WP_001385393.1 antirestriction protein -
QJP90_RS09570 (2004027) 2004027..2004848 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJP90_RS09575 (2005069) 2005069..2005479 - 411 WP_000846704.1 hypothetical protein -
QJP90_RS09580 (2005495) 2005495..2006172 - 678 WP_001362823.1 hypothetical protein -
QJP90_RS09585 (2006308) 2006308..2007378 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T279540 WP_000854814.1 NZ_CP124337:c2001978-2001604 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13636.51 Da        Isoelectric Point: 6.6249

>AT279540 WP_001285592.1 NZ_CP124337:c2002435-2002067 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A0H0EA76

References