Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4969891..4970722 | Replicon | chromosome |
Accession | NZ_CP124334 | ||
Organism | Escherichia coli strain AVS0786 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1P968 |
Locus tag | QJP89_RS24055 | Protein ID | WP_000854814.1 |
Coordinates | 4969891..4970265 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A641DSP2 |
Locus tag | QJP89_RS24060 | Protein ID | WP_001546021.1 |
Coordinates | 4970354..4970722 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP89_RS24020 (4965886) | 4965886..4966215 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
QJP89_RS24025 (4966316) | 4966316..4966639 | - | 324 | WP_223216378.1 | EutP/PduV family microcompartment system protein | - |
QJP89_RS24030 (4966618) | 4966618..4966698 | + | 81 | WP_023441679.1 | hypothetical protein | - |
QJP89_RS24035 (4966909) | 4966909..4968450 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
QJP89_RS24040 (4968465) | 4968465..4969211 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
QJP89_RS24045 (4969574) | 4969574..4969654 | - | 81 | Protein_4706 | hypothetical protein | - |
QJP89_RS24050 (4969700) | 4969700..4969894 | - | 195 | WP_000988601.1 | DUF5983 family protein | - |
QJP89_RS24055 (4969891) | 4969891..4970265 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
QJP89_RS24060 (4970354) | 4970354..4970722 | - | 369 | WP_001546021.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
QJP89_RS24065 (4970802) | 4970802..4971023 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
QJP89_RS24070 (4971086) | 4971086..4971562 | - | 477 | WP_001186773.1 | RadC family protein | - |
QJP89_RS24075 (4971578) | 4971578..4972051 | - | 474 | WP_001385393.1 | antirestriction protein | - |
QJP89_RS24080 (4972314) | 4972314..4973135 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
QJP89_RS24085 (4973356) | 4973356..4973766 | - | 411 | WP_000846704.1 | hypothetical protein | - |
QJP89_RS24090 (4973782) | 4973782..4974459 | - | 678 | WP_001362823.1 | hypothetical protein | - |
QJP89_RS24095 (4974595) | 4974595..4975665 | - | 1071 | WP_000102631.1 | patatin-like phospholipase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T279532 WP_000854814.1 NZ_CP124334:c4970265-4969891 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13607.47 Da Isoelectric Point: 6.3139
>AT279532 WP_001546021.1 NZ_CP124334:c4970722-4970354 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FY50 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A641DSP2 |