Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4969891..4970722 Replicon chromosome
Accession NZ_CP124334
Organism Escherichia coli strain AVS0786

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP89_RS24055 Protein ID WP_000854814.1
Coordinates 4969891..4970265 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP89_RS24060 Protein ID WP_001546021.1
Coordinates 4970354..4970722 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP89_RS24020 (4965886) 4965886..4966215 + 330 WP_000450409.1 DUF496 family protein -
QJP89_RS24025 (4966316) 4966316..4966639 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP89_RS24030 (4966618) 4966618..4966698 + 81 WP_023441679.1 hypothetical protein -
QJP89_RS24035 (4966909) 4966909..4968450 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJP89_RS24040 (4968465) 4968465..4969211 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP89_RS24045 (4969574) 4969574..4969654 - 81 Protein_4706 hypothetical protein -
QJP89_RS24050 (4969700) 4969700..4969894 - 195 WP_000988601.1 DUF5983 family protein -
QJP89_RS24055 (4969891) 4969891..4970265 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP89_RS24060 (4970354) 4970354..4970722 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP89_RS24065 (4970802) 4970802..4971023 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJP89_RS24070 (4971086) 4971086..4971562 - 477 WP_001186773.1 RadC family protein -
QJP89_RS24075 (4971578) 4971578..4972051 - 474 WP_001385393.1 antirestriction protein -
QJP89_RS24080 (4972314) 4972314..4973135 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJP89_RS24085 (4973356) 4973356..4973766 - 411 WP_000846704.1 hypothetical protein -
QJP89_RS24090 (4973782) 4973782..4974459 - 678 WP_001362823.1 hypothetical protein -
QJP89_RS24095 (4974595) 4974595..4975665 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T279532 WP_000854814.1 NZ_CP124334:c4970265-4969891 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT279532 WP_001546021.1 NZ_CP124334:c4970722-4970354 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References