Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3783040..3783874 | Replicon | chromosome |
| Accession | NZ_CP124334 | ||
| Organism | Escherichia coli strain AVS0786 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QJP89_RS18495 | Protein ID | WP_001546109.1 |
| Coordinates | 3783040..3783417 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QJP89_RS18500 | Protein ID | WP_282517600.1 |
| Coordinates | 3783494..3783874 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP89_RS18465 (3779434) | 3779434..3779604 | - | 171 | Protein_3612 | IS110 family transposase | - |
| QJP89_RS18470 (3780021) | 3780021..3780955 | - | 935 | Protein_3613 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJP89_RS18475 (3780948) | 3780948..3781343 | - | 396 | WP_000208383.1 | DUF6088 family protein | - |
| QJP89_RS18480 (3781412) | 3781412..3782257 | - | 846 | WP_001280441.1 | DUF4942 domain-containing protein | - |
| QJP89_RS18485 (3782342) | 3782342..3782539 | - | 198 | WP_000839260.1 | DUF957 domain-containing protein | - |
| QJP89_RS18490 (3782556) | 3782556..3783043 | - | 488 | Protein_3617 | DUF5983 family protein | - |
| QJP89_RS18495 (3783040) | 3783040..3783417 | - | 378 | WP_001546109.1 | TA system toxin CbtA family protein | Toxin |
| QJP89_RS18500 (3783494) | 3783494..3783874 | - | 381 | WP_282517600.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP89_RS18505 (3783924) | 3783924..3784568 | - | 645 | WP_000086755.1 | hypothetical protein | - |
| QJP89_RS18510 (3784587) | 3784587..3784808 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP89_RS18515 (3784877) | 3784877..3785353 | - | 477 | WP_001424026.1 | RadC family protein | - |
| QJP89_RS18520 (3785369) | 3785369..3785854 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| QJP89_RS18525 (3785909) | 3785909..3786727 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJP89_RS18530 (3786827) | 3786827..3787060 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| QJP89_RS18535 (3787139) | 3787139..3787594 | - | 456 | WP_001545736.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.00 Da Isoelectric Point: 8.5190
>T279529 WP_001546109.1 NZ_CP124334:c3783417-3783040 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 14069.84 Da Isoelectric Point: 4.8331
>AT279529 WP_282517600.1 NZ_CP124334:c3783874-3783494 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLESCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLESCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|