Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2404921..2405756 | Replicon | chromosome |
| Accession | NZ_CP124334 | ||
| Organism | Escherichia coli strain AVS0786 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q8VR61 |
| Locus tag | QJP89_RS11975 | Protein ID | WP_000854747.1 |
| Coordinates | 2405379..2405756 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A6A0PK89 |
| Locus tag | QJP89_RS11970 | Protein ID | WP_024186867.1 |
| Coordinates | 2404921..2405289 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP89_RS11935 (2400833) | 2400833..2401513 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| QJP89_RS11940 (2401661) | 2401661..2402338 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| QJP89_RS11945 (2402344) | 2402344..2402577 | + | 234 | WP_001278280.1 | DUF905 family protein | - |
| QJP89_RS11950 (2402667) | 2402667..2403485 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
| QJP89_RS11955 (2403576) | 2403576..2404061 | + | 486 | WP_001588934.1 | antirestriction protein | - |
| QJP89_RS11960 (2404076) | 2404076..2404552 | + | 477 | WP_001588933.1 | RadC family protein | - |
| QJP89_RS11965 (2404621) | 2404621..2404842 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QJP89_RS11970 (2404921) | 2404921..2405289 | + | 369 | WP_024186867.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP89_RS11975 (2405379) | 2405379..2405756 | + | 378 | WP_000854747.1 | TA system toxin CbtA family protein | Toxin |
| QJP89_RS11980 (2405753) | 2405753..2406241 | + | 489 | WP_000761667.1 | DUF5983 family protein | - |
| QJP89_RS11985 (2406253) | 2406253..2406450 | + | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
| QJP89_RS11990 (2406535) | 2406535..2407389 | + | 855 | WP_001588930.1 | DUF4942 domain-containing protein | - |
| QJP89_RS11995 (2407707) | 2407707..2407866 | + | 160 | Protein_2358 | integrase | - |
| QJP89_RS12000 (2408126) | 2408126..2409664 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2392237..2433160 | 40923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14095.03 Da Isoelectric Point: 6.8524
>T279523 WP_000854747.1 NZ_CP124334:2405379-2405756 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13555.35 Da Isoelectric Point: 6.4745
>AT279523 WP_024186867.1 NZ_CP124334:2404921-2405289 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2VFZ1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6A0PK89 |