Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 1908593..1909143 Replicon chromosome
Accession NZ_CP124334
Organism Escherichia coli strain AVS0786

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP89_RS09540 Protein ID WP_001160966.1
Coordinates 1908593..1908907 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP89_RS09545 Protein ID WP_000125566.1
Coordinates 1908910..1909143 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP89_RS09515 (1904268) 1904268..1905554 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP89_RS09520 (1905554) 1905554..1906543 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP89_RS09525 (1906540) 1906540..1907361 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP89_RS09530 (1907364) 1907364..1907741 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP89_RS09535 (1907748) 1907748..1908596 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP89_RS09540 (1908593) 1908593..1908907 - 315 WP_001160966.1 CcdB family protein Toxin
QJP89_RS09545 (1908910) 1908910..1909143 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP89_RS09550 (1909229) 1909229..1909708 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP89_RS09555 (1909900) 1909900..1911762 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP89_RS09560 (1911755) 1911755..1912285 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP89_RS09565 (1912393) 1912393..1913724 - 1332 WP_001183207.1 MFS transporter -
QJP89_RS09570 (1913783) 1913783..1914070 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T279520 WP_001160966.1 NZ_CP124334:c1908907-1908593 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT279520 WP_000125566.1 NZ_CP124334:c1909143-1908910 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References