Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 94592..95117 | Replicon | plasmid pAVS0753-A |
Accession | NZ_CP124333 | ||
Organism | Escherichia coli strain AVS0753 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | QJP82_RS26780 | Protein ID | WP_001159871.1 |
Coordinates | 94592..94897 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | H9TJP1 |
Locus tag | QJP82_RS26785 | Protein ID | WP_000813630.1 |
Coordinates | 94899..95117 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP82_RS26765 (90554) | 90554..91720 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QJP82_RS26770 (92308) | 92308..93063 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QJP82_RS26775 (93785) | 93785..94591 | - | 807 | WP_000016970.1 | site-specific integrase | - |
QJP82_RS26780 (94592) | 94592..94897 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QJP82_RS26785 (94899) | 94899..95117 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QJP82_RS26790 (95677) | 95677..95907 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
QJP82_RS26795 (95904) | 95904..96320 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
QJP82_RS26800 (96395) | 96395..97960 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
QJP82_RS26805 (97945) | 97945..98967 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | iutA / iucD | 1..105993 | 105993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T279510 WP_001159871.1 NZ_CP124333:c94897-94592 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CEF5 |