Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2035388..2036222 | Replicon | chromosome |
| Accession | NZ_CP124332 | ||
| Organism | Escherichia coli strain AVS0753 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | QJP82_RS10205 | Protein ID | WP_000854690.1 |
| Coordinates | 2035845..2036222 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | QJP82_RS10200 | Protein ID | WP_001305076.1 |
| Coordinates | 2035388..2035756 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP82_RS10160 (2030470) | 2030470..2031597 | + | 1128 | Protein_1994 | hypothetical protein | - |
| QJP82_RS10165 (2031673) | 2031673..2032128 | + | 456 | WP_000581502.1 | IrmA family protein | - |
| QJP82_RS10170 (2032207) | 2032207..2032440 | + | 234 | WP_000902034.1 | DUF905 family protein | - |
| QJP82_RS10175 (2032541) | 2032541..2033359 | + | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJP82_RS10180 (2033414) | 2033414..2033899 | + | 486 | WP_000849565.1 | antirestriction protein | - |
| QJP82_RS10185 (2033915) | 2033915..2034391 | + | 477 | WP_001186726.1 | RadC family protein | - |
| QJP82_RS10190 (2034454) | 2034454..2034675 | + | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| QJP82_RS10195 (2034694) | 2034694..2035338 | + | 645 | WP_000094916.1 | hypothetical protein | - |
| QJP82_RS10200 (2035388) | 2035388..2035756 | + | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP82_RS10205 (2035845) | 2035845..2036222 | + | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| QJP82_RS10210 (2036219) | 2036219..2036707 | + | 489 | WP_000761699.1 | DUF5983 family protein | - |
| QJP82_RS10215 (2036724) | 2036724..2036921 | + | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| QJP82_RS10220 (2037006) | 2037006..2037851 | + | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| QJP82_RS10225 (2037920) | 2037920..2038315 | + | 396 | WP_000208384.1 | DUF6088 family protein | - |
| QJP82_RS10230 (2038308) | 2038308..2039241 | + | 934 | Protein_2008 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJP82_RS10235 (2039658) | 2039658..2039828 | + | 171 | Protein_2009 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2039673..2039828 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T279485 WP_000854690.1 NZ_CP124332:2035845-2036222 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT279485 WP_001305076.1 NZ_CP124332:2035388-2035756 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|