Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 866221..867052 Replicon chromosome
Accession NZ_CP124332
Organism Escherichia coli strain AVS0753

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP82_RS04580 Protein ID WP_000854815.1
Coordinates 866678..867052 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP82_RS04575 Protein ID WP_001280918.1
Coordinates 866221..866589 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP82_RS04530 (861310) 861310..862056 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP82_RS04535 (862139) 862139..862489 + 351 Protein_895 hypothetical protein -
QJP82_RS04540 (862505) 862505..862915 + 411 WP_000846703.1 hypothetical protein -
QJP82_RS04545 (863136) 863136..863954 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJP82_RS04550 (863954) 863954..864199 + 246 WP_001164966.1 hypothetical protein -
QJP82_RS04555 (864293) 864293..864766 + 474 WP_001542276.1 antirestriction protein -
QJP82_RS04560 (864782) 864782..865258 + 477 WP_001186200.1 RadC family protein -
QJP82_RS04565 (865321) 865321..865542 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP82_RS04570 (865561) 865561..866205 + 645 WP_000086752.1 hypothetical protein -
QJP82_RS04575 (866221) 866221..866589 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP82_RS04580 (866678) 866678..867052 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP82_RS04585 (867049) 867049..867243 + 195 WP_000988600.1 DUF5983 family protein -
QJP82_RS04590 (867289) 867289..867369 + 81 Protein_906 hypothetical protein -
QJP82_RS04595 (867658) 867658..867738 - 81 WP_023441679.1 hypothetical protein -
QJP82_RS04600 (867717) 867717..868040 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP82_RS04605 (868141) 868141..868470 - 330 WP_000450409.1 DUF496 family protein -
QJP82_RS04610 (868642) 868642..869700 - 1059 WP_001200889.1 FUSC family protein -
QJP82_RS04615 (869898) 869898..870371 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP82_RS04620 (870490) 870490..871656 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T279482 WP_000854815.1 NZ_CP124332:866678-867052 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT279482 WP_001280918.1 NZ_CP124332:866221-866589 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References