Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 138184..138709 Replicon plasmid pAVS0787-A
Accession NZ_CP124329
Organism Escherichia coli strain AVS0787

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag QJP62_RS26980 Protein ID WP_001159871.1
Coordinates 138184..138489 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag QJP62_RS26985 Protein ID WP_000813630.1
Coordinates 138491..138709 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP62_RS26965 (134146) 134146..135312 - 1167 WP_000772446.1 plasmid-partitioning protein SopA -
QJP62_RS26970 (135900) 135900..136655 - 756 WP_000852146.1 replication initiation protein RepE -
QJP62_RS26975 (137377) 137377..138183 - 807 WP_000016970.1 site-specific integrase -
QJP62_RS26980 (138184) 138184..138489 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
QJP62_RS26985 (138491) 138491..138709 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QJP62_RS26990 (139269) 139269..139499 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
QJP62_RS26995 (139496) 139496..139912 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
QJP62_RS27000 (139987) 139987..141552 + 1566 WP_282517440.1 AAA family ATPase -
QJP62_RS27005 (141537) 141537..142559 + 1023 WP_000361402.1 helicase UvrD -
QJP62_RS27010 (143256) 143256..143257 - 2 WP_001743396.1 IS1-like element IS1A family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - senB / iutA / iutA / iucD 1..149581 149581


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T279470 WP_001159871.1 NZ_CP124329:c138489-138184 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT279470 WP_000813630.1 NZ_CP124329:c138709-138491 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References