Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 3517451..3518251 | Replicon | chromosome |
Accession | NZ_CP124328 | ||
Organism | Escherichia coli strain AVS0787 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4T503 |
Locus tag | QJP62_RS17440 | Protein ID | WP_000342452.1 |
Coordinates | 3517724..3518251 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4T504 |
Locus tag | QJP62_RS17435 | Protein ID | WP_001277107.1 |
Coordinates | 3517451..3517717 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP62_RS17415 (3513110) | 3513110..3513778 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
QJP62_RS17420 (3513771) | 3513771..3514829 | + | 1059 | WP_001042013.1 | permease-like cell division protein FtsX | - |
QJP62_RS17425 (3515074) | 3515074..3515928 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
QJP62_RS17430 (3516199) | 3516199..3517302 | + | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
QJP62_RS17435 (3517451) | 3517451..3517717 | + | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
QJP62_RS17440 (3517724) | 3517724..3518251 | + | 528 | WP_000342452.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
QJP62_RS17445 (3518248) | 3518248..3518631 | - | 384 | WP_000778796.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
QJP62_RS17450 (3519054) | 3519054..3520163 | + | 1110 | WP_001296485.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
QJP62_RS17455 (3520211) | 3520211..3521137 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
QJP62_RS17460 (3521134) | 3521134..3522411 | + | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
QJP62_RS17465 (3522408) | 3522408..3523175 | + | 768 | WP_000082099.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.57 Da Isoelectric Point: 6.6348
>T279454 WP_000342452.1 NZ_CP124328:3517724-3518251 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061K5K9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061YQ57 |