Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 2191330..2191850 Replicon chromosome
Accession NZ_CP124328
Organism Escherichia coli strain AVS0787

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QJP62_RS11170 Protein ID WP_001160964.1
Coordinates 2191330..2191614 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP62_RS11175 Protein ID WP_000125566.1
Coordinates 2191617..2191850 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP62_RS11145 (2186975) 2186975..2188261 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP62_RS11150 (2188261) 2188261..2189250 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP62_RS11155 (2189247) 2189247..2190068 + 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP62_RS11160 (2190071) 2190071..2190448 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP62_RS11165 (2190455) 2190455..2191303 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP62_RS11170 (2191330) 2191330..2191614 - 285 WP_001160964.1 CcdB family protein Toxin
QJP62_RS11175 (2191617) 2191617..2191850 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP62_RS11180 (2191936) 2191936..2192415 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP62_RS11185 (2192607) 2192607..2194469 - 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
QJP62_RS11190 (2194462) 2194462..2194992 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP62_RS11195 (2195100) 2195100..2196431 - 1332 WP_001183209.1 MFS transporter -
QJP62_RS11200 (2196490) 2196490..2196777 - 288 WP_000203744.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T279447 WP_001160964.1 NZ_CP124328:c2191614-2191330 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT279447 WP_000125566.1 NZ_CP124328:c2191850-2191617 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References