Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1739653..1740271 | Replicon | chromosome |
| Accession | NZ_CP124328 | ||
| Organism | Escherichia coli strain AVS0787 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QJP62_RS09015 | Protein ID | WP_001291435.1 |
| Coordinates | 1740053..1740271 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QJP62_RS09010 | Protein ID | WP_000344800.1 |
| Coordinates | 1739653..1740027 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP62_RS09000 (1734742) | 1734742..1735935 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QJP62_RS09005 (1735958) | 1735958..1739107 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| QJP62_RS09010 (1739653) | 1739653..1740027 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QJP62_RS09015 (1740053) | 1740053..1740271 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QJP62_RS09020 (1740445) | 1740445..1740996 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QJP62_RS09025 (1741112) | 1741112..1741582 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QJP62_RS09030 (1741746) | 1741746..1743296 | + | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QJP62_RS09035 (1743338) | 1743338..1743691 | - | 354 | WP_000878135.1 | DUF1428 family protein | - |
| QJP62_RS09045 (1744070) | 1744070..1744381 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| QJP62_RS09050 (1744412) | 1744412..1744984 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T279445 WP_001291435.1 NZ_CP124328:1740053-1740271 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT279445 WP_000344800.1 NZ_CP124328:1739653-1740027 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |