Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2023538..2024369 | Replicon | chromosome |
| Accession | NZ_CP124326 | ||
| Organism | Escherichia coli strain AVS0285 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | QJP69_RS09670 | Protein ID | WP_000854814.1 |
| Coordinates | 2023538..2023912 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A641DSP2 |
| Locus tag | QJP69_RS09675 | Protein ID | WP_001546021.1 |
| Coordinates | 2024001..2024369 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP69_RS09635 (2019533) | 2019533..2019862 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| QJP69_RS09640 (2019963) | 2019963..2020286 | - | 324 | WP_223216378.1 | EutP/PduV family microcompartment system protein | - |
| QJP69_RS09645 (2020265) | 2020265..2020345 | + | 81 | WP_023441679.1 | hypothetical protein | - |
| QJP69_RS09650 (2020556) | 2020556..2022097 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QJP69_RS09655 (2022112) | 2022112..2022858 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP69_RS09660 (2023221) | 2023221..2023301 | - | 81 | Protein_1896 | hypothetical protein | - |
| QJP69_RS09665 (2023347) | 2023347..2023541 | - | 195 | WP_000988601.1 | DUF5983 family protein | - |
| QJP69_RS09670 (2023538) | 2023538..2023912 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QJP69_RS09675 (2024001) | 2024001..2024369 | - | 369 | WP_001546021.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP69_RS09680 (2024449) | 2024449..2024670 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QJP69_RS09685 (2024733) | 2024733..2025209 | - | 477 | WP_001186773.1 | RadC family protein | - |
| QJP69_RS09690 (2025225) | 2025225..2025698 | - | 474 | WP_001385393.1 | antirestriction protein | - |
| QJP69_RS09695 (2025961) | 2025961..2026782 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
| QJP69_RS09700 (2027003) | 2027003..2027413 | - | 411 | WP_000846704.1 | hypothetical protein | - |
| QJP69_RS09705 (2027429) | 2027429..2028106 | - | 678 | WP_001362823.1 | hypothetical protein | - |
| QJP69_RS09710 (2028242) | 2028242..2029312 | - | 1071 | WP_000102631.1 | patatin-like phospholipase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T279422 WP_000854814.1 NZ_CP124326:c2023912-2023538 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13607.47 Da Isoelectric Point: 6.3139
>AT279422 WP_001546021.1 NZ_CP124326:c2024369-2024001 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A641DSP2 |