Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4226156..4226990 | Replicon | chromosome |
| Accession | NZ_CP124324 | ||
| Organism | Escherichia coli strain AVS0536 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QJP54_RS20640 | Protein ID | WP_000854770.1 |
| Coordinates | 4226156..4226533 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QJP54_RS20645 | Protein ID | WP_001280950.1 |
| Coordinates | 4226622..4226990 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP54_RS20615 (4222267) | 4222267..4223889 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QJP54_RS20620 (4224680) | 4224680..4224856 | - | 177 | Protein_4049 | helix-turn-helix domain-containing protein | - |
| QJP54_RS20625 (4225223) | 4225223..4225372 | - | 150 | Protein_4050 | hypothetical protein | - |
| QJP54_RS20630 (4225478) | 4225478..4225654 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP54_RS20635 (4225671) | 4225671..4226159 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP54_RS20640 (4226156) | 4226156..4226533 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QJP54_RS20645 (4226622) | 4226622..4226990 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP54_RS20650 (4227153) | 4227153..4227374 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QJP54_RS20655 (4227437) | 4227437..4227913 | - | 477 | WP_001186779.1 | RadC family protein | - |
| QJP54_RS20660 (4227929) | 4227929..4228393 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| QJP54_RS20665 (4228735) | 4228735..4229553 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| QJP54_RS20670 (4229671) | 4229671..4229866 | - | 196 | Protein_4059 | DUF905 family protein | - |
| QJP54_RS20675 (4229937) | 4229937..4231838 | - | 1902 | Protein_4060 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4214510..4254719 | 40209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T279412 WP_000854770.1 NZ_CP124324:c4226533-4226156 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT279412 WP_001280950.1 NZ_CP124324:c4226990-4226622 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |