Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2023654..2024485 Replicon chromosome
Accession NZ_CP124322
Organism Escherichia coli strain AVS0717

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJB10_RS09675 Protein ID WP_000854814.1
Coordinates 2023654..2024028 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJB10_RS09680 Protein ID WP_001546021.1
Coordinates 2024117..2024485 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB10_RS09640 (2019649) 2019649..2019978 + 330 WP_000450409.1 DUF496 family protein -
QJB10_RS09645 (2020079) 2020079..2020402 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJB10_RS09650 (2020381) 2020381..2020461 + 81 WP_023441679.1 hypothetical protein -
QJB10_RS09655 (2020672) 2020672..2022213 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJB10_RS09660 (2022228) 2022228..2022974 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJB10_RS09665 (2023337) 2023337..2023417 - 81 Protein_1896 hypothetical protein -
QJB10_RS09670 (2023463) 2023463..2023657 - 195 WP_000988601.1 DUF5983 family protein -
QJB10_RS09675 (2023654) 2023654..2024028 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJB10_RS09680 (2024117) 2024117..2024485 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJB10_RS09685 (2024565) 2024565..2024786 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJB10_RS09690 (2024849) 2024849..2025325 - 477 WP_001610726.1 RadC family protein -
QJB10_RS09695 (2025341) 2025341..2025814 - 474 WP_001385393.1 antirestriction protein -
QJB10_RS09700 (2026077) 2026077..2026898 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJB10_RS09705 (2027119) 2027119..2027529 - 411 WP_000846704.1 hypothetical protein -
QJB10_RS09710 (2027545) 2027545..2028222 - 678 WP_001362823.1 hypothetical protein -
QJB10_RS09715 (2028358) 2028358..2029428 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T279378 WP_000854814.1 NZ_CP124322:c2024028-2023654 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT279378 WP_001546021.1 NZ_CP124322:c2024485-2024117 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References