Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4251731..4252565 Replicon chromosome
Accession NZ_CP124320
Organism Escherichia coli strain AVS0754

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag QJP81_RS20735 Protein ID WP_001546109.1
Coordinates 4252188..4252565 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A7I0L0C8
Locus tag QJP81_RS20730 Protein ID WP_001546108.1
Coordinates 4251731..4252111 (+) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP81_RS20695 (4248011) 4248011..4248466 + 456 WP_001545736.1 IrmA family protein -
QJP81_RS20700 (4248545) 4248545..4248778 + 234 WP_001119729.1 DUF905 family protein -
QJP81_RS20705 (4248878) 4248878..4249696 + 819 WP_001234620.1 DUF932 domain-containing protein -
QJP81_RS20710 (4249751) 4249751..4250236 + 486 WP_000849588.1 antirestriction protein -
QJP81_RS20715 (4250252) 4250252..4250728 + 477 WP_001424026.1 RadC family protein -
QJP81_RS20720 (4250797) 4250797..4251018 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP81_RS20725 (4251037) 4251037..4251681 + 645 WP_000086755.1 hypothetical protein -
QJP81_RS20730 (4251731) 4251731..4252111 + 381 WP_001546108.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP81_RS20735 (4252188) 4252188..4252565 + 378 WP_001546109.1 TA system toxin CbtA family protein Toxin
QJP81_RS20740 (4252562) 4252562..4253049 + 488 Protein_4070 DUF5983 family protein -
QJP81_RS20745 (4253066) 4253066..4253263 + 198 WP_000839260.1 DUF957 domain-containing protein -
QJP81_RS20750 (4253348) 4253348..4254193 + 846 WP_001280441.1 DUF4942 domain-containing protein -
QJP81_RS20755 (4254262) 4254262..4254657 + 396 WP_000208383.1 DUF6088 family protein -
QJP81_RS20760 (4254650) 4254650..4255584 + 935 Protein_4074 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJP81_RS20765 (4256001) 4256001..4256171 + 171 Protein_4075 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13986.00 Da        Isoelectric Point: 8.5190

>T279368 WP_001546109.1 NZ_CP124320:4252188-4252565 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13997.78 Da        Isoelectric Point: 5.0823

>AT279368 WP_001546108.1 NZ_CP124320:4251731-4252111 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7I0L0C8

References