Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3200405..3201236 Replicon chromosome
Accession NZ_CP124320
Organism Escherichia coli strain AVS0754

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP81_RS15880 Protein ID WP_000854814.1
Coordinates 3200862..3201236 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP81_RS15875 Protein ID WP_001546021.1
Coordinates 3200405..3200773 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP81_RS15840 (3195462) 3195462..3196532 + 1071 WP_000102631.1 patatin-like phospholipase family protein -
QJP81_RS15845 (3196668) 3196668..3197345 + 678 WP_001362823.1 hypothetical protein -
QJP81_RS15850 (3197361) 3197361..3197771 + 411 WP_000846704.1 hypothetical protein -
QJP81_RS15855 (3197992) 3197992..3198813 + 822 WP_001234710.1 DUF932 domain-containing protein -
QJP81_RS15860 (3199076) 3199076..3199549 + 474 WP_001385393.1 antirestriction protein -
QJP81_RS15865 (3199565) 3199565..3200041 + 477 WP_001186773.1 RadC family protein -
QJP81_RS15870 (3200104) 3200104..3200325 + 222 WP_000692323.1 DUF987 domain-containing protein -
QJP81_RS15875 (3200405) 3200405..3200773 + 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP81_RS15880 (3200862) 3200862..3201236 + 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP81_RS15885 (3201233) 3201233..3201427 + 195 WP_000988601.1 DUF5983 family protein -
QJP81_RS15890 (3201473) 3201473..3201553 + 81 Protein_3121 hypothetical protein -
QJP81_RS15895 (3201916) 3201916..3202662 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP81_RS15900 (3202677) 3202677..3204218 - 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJP81_RS15905 (3204429) 3204429..3204509 - 81 WP_023441679.1 hypothetical protein -
QJP81_RS15910 (3204488) 3204488..3204811 + 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP81_RS15915 (3204912) 3204912..3205241 - 330 WP_000450409.1 DUF496 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T279365 WP_000854814.1 NZ_CP124320:3200862-3201236 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT279365 WP_001546021.1 NZ_CP124320:3200405-3200773 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References