Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3200405..3201236 | Replicon | chromosome |
Accession | NZ_CP124320 | ||
Organism | Escherichia coli strain AVS0754 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1P968 |
Locus tag | QJP81_RS15880 | Protein ID | WP_000854814.1 |
Coordinates | 3200862..3201236 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A641DSP2 |
Locus tag | QJP81_RS15875 | Protein ID | WP_001546021.1 |
Coordinates | 3200405..3200773 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP81_RS15840 (3195462) | 3195462..3196532 | + | 1071 | WP_000102631.1 | patatin-like phospholipase family protein | - |
QJP81_RS15845 (3196668) | 3196668..3197345 | + | 678 | WP_001362823.1 | hypothetical protein | - |
QJP81_RS15850 (3197361) | 3197361..3197771 | + | 411 | WP_000846704.1 | hypothetical protein | - |
QJP81_RS15855 (3197992) | 3197992..3198813 | + | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
QJP81_RS15860 (3199076) | 3199076..3199549 | + | 474 | WP_001385393.1 | antirestriction protein | - |
QJP81_RS15865 (3199565) | 3199565..3200041 | + | 477 | WP_001186773.1 | RadC family protein | - |
QJP81_RS15870 (3200104) | 3200104..3200325 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
QJP81_RS15875 (3200405) | 3200405..3200773 | + | 369 | WP_001546021.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
QJP81_RS15880 (3200862) | 3200862..3201236 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
QJP81_RS15885 (3201233) | 3201233..3201427 | + | 195 | WP_000988601.1 | DUF5983 family protein | - |
QJP81_RS15890 (3201473) | 3201473..3201553 | + | 81 | Protein_3121 | hypothetical protein | - |
QJP81_RS15895 (3201916) | 3201916..3202662 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
QJP81_RS15900 (3202677) | 3202677..3204218 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
QJP81_RS15905 (3204429) | 3204429..3204509 | - | 81 | WP_023441679.1 | hypothetical protein | - |
QJP81_RS15910 (3204488) | 3204488..3204811 | + | 324 | WP_223216378.1 | EutP/PduV family microcompartment system protein | - |
QJP81_RS15915 (3204912) | 3204912..3205241 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T279365 WP_000854814.1 NZ_CP124320:3200862-3201236 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13607.47 Da Isoelectric Point: 6.3139
>AT279365 WP_001546021.1 NZ_CP124320:3200405-3200773 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FY50 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A641DSP2 |