Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 1149332..1149882 Replicon chromosome
Accession NZ_CP124320
Organism Escherichia coli strain AVS0754

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP81_RS05610 Protein ID WP_001160966.1
Coordinates 1149568..1149882 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP81_RS05605 Protein ID WP_000125566.1
Coordinates 1149332..1149565 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP81_RS05580 (1144405) 1144405..1144692 + 288 WP_000203741.1 ferredoxin-like protein FixX -
QJP81_RS05585 (1144751) 1144751..1146082 + 1332 WP_001183207.1 MFS transporter -
QJP81_RS05590 (1146190) 1146190..1146720 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP81_RS05595 (1146713) 1146713..1148575 + 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP81_RS05600 (1148767) 1148767..1149246 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP81_RS05605 (1149332) 1149332..1149565 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP81_RS05610 (1149568) 1149568..1149882 + 315 WP_001160966.1 CcdB family protein Toxin
QJP81_RS05615 (1149879) 1149879..1150727 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP81_RS05620 (1150734) 1150734..1151111 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP81_RS05625 (1151114) 1151114..1151935 - 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP81_RS05630 (1151932) 1151932..1152921 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP81_RS05635 (1152921) 1152921..1154207 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T279352 WP_001160966.1 NZ_CP124320:1149568-1149882 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT279352 WP_000125566.1 NZ_CP124320:1149332-1149565 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References