Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 968481..969315 | Replicon | chromosome |
Accession | NZ_CP124320 | ||
Organism | Escherichia coli strain AVS0754 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
Locus tag | QJP81_RS04700 | Protein ID | WP_000854770.1 |
Coordinates | 968938..969315 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1M1N885 |
Locus tag | QJP81_RS04695 | Protein ID | WP_001280950.1 |
Coordinates | 968481..968849 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP81_RS04665 (963633) | 963633..965534 | + | 1902 | Protein_920 | Ag43/Cah family autotransporter adhesin | - |
QJP81_RS04670 (965605) | 965605..965800 | + | 196 | Protein_921 | DUF905 family protein | - |
QJP81_RS04675 (965918) | 965918..966736 | + | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
QJP81_RS04680 (967078) | 967078..967542 | + | 465 | WP_000855061.1 | antirestriction protein | - |
QJP81_RS04685 (967558) | 967558..968034 | + | 477 | WP_001186779.1 | RadC family protein | - |
QJP81_RS04690 (968097) | 968097..968318 | + | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
QJP81_RS04695 (968481) | 968481..968849 | + | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QJP81_RS04700 (968938) | 968938..969315 | + | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
QJP81_RS04705 (969312) | 969312..969800 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
QJP81_RS04710 (969817) | 969817..969993 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
QJP81_RS04715 (970099) | 970099..970248 | + | 150 | Protein_930 | hypothetical protein | - |
QJP81_RS04720 (970615) | 970615..970920 | + | 306 | Protein_931 | helix-turn-helix domain-containing protein | - |
QJP81_RS04725 (971582) | 971582..973204 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 920468..980961 | 60493 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T279350 WP_000854770.1 NZ_CP124320:968938-969315 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1J6XFW9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M1N885 |