Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 703345..704180 | Replicon | chromosome |
| Accession | NZ_CP124320 | ||
| Organism | Escherichia coli strain AVS0754 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A5F0P695 |
| Locus tag | QJP81_RS03340 | Protein ID | WP_022645116.1 |
| Coordinates | 703345..703722 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QJP81_RS03345 | Protein ID | WP_078046143.1 |
| Coordinates | 703812..704180 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP81_RS03315 (699709) | 699709..701250 | - | 1542 | WP_115790657.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
| QJP81_RS03320 (701510) | 701510..701669 | - | 160 | Protein_656 | integrase | - |
| QJP81_RS03325 (701999) | 701999..702841 | - | 843 | WP_022645115.1 | DUF4942 domain-containing protein | - |
| QJP81_RS03330 (702926) | 702926..703120 | - | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| QJP81_RS03335 (703199) | 703199..703348 | - | 150 | Protein_659 | DUF5983 family protein | - |
| QJP81_RS03340 (703345) | 703345..703722 | - | 378 | WP_022645116.1 | TA system toxin CbtA family protein | Toxin |
| QJP81_RS03345 (703812) | 703812..704180 | - | 369 | WP_078046143.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP81_RS03350 (704343) | 704343..704564 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP81_RS03355 (704627) | 704627..705103 | - | 477 | WP_022645117.1 | RadC family protein | - |
| QJP81_RS03360 (705119) | 705119..705598 | - | 480 | WP_001564060.1 | antirestriction protein | - |
| QJP81_RS03365 (705864) | 705864..706682 | - | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| QJP81_RS03370 (706772) | 706772..707005 | - | 234 | WP_001278293.1 | DUF905 family protein | - |
| QJP81_RS03375 (707011) | 707011..707688 | - | 678 | WP_001097302.1 | hypothetical protein | - |
| QJP81_RS03380 (707836) | 707836..708516 | - | 681 | WP_001282921.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | blaCTX-M-15 | - | 692658..740999 | 48341 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14021.99 Da Isoelectric Point: 7.8045
>T279349 WP_022645116.1 NZ_CP124320:c703722-703345 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGIALCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGIALCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13602.39 Da Isoelectric Point: 6.7390
>AT279349 WP_078046143.1 NZ_CP124320:c704180-703812 [Escherichia coli]
VSDTLSGATHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGATHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|