Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1259310..1259929 | Replicon | chromosome |
Accession | NZ_CP124220 | ||
Organism | Klebsiella pneumoniae strain Z |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | QG930_RS06000 | Protein ID | WP_002892050.1 |
Coordinates | 1259310..1259528 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | QG930_RS06005 | Protein ID | WP_002892066.1 |
Coordinates | 1259555..1259929 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QG930_RS05965 (QG930_05965) | 1255357..1255620 | + | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
QG930_RS05970 (QG930_05970) | 1255620..1255760 | + | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
QG930_RS05975 (QG930_05975) | 1255757..1256455 | - | 699 | WP_004893822.1 | GNAT family protein | - |
QG930_RS05980 (QG930_05980) | 1256556..1258007 | + | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
QG930_RS05985 (QG930_05985) | 1257982..1258452 | - | 471 | WP_002892026.1 | YlaC family protein | - |
QG930_RS05990 (QG930_05990) | 1258473..1258613 | + | 141 | WP_032409038.1 | hypothetical protein | - |
QG930_RS05995 (QG930_05995) | 1258585..1259151 | - | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
QG930_RS06000 (QG930_06000) | 1259310..1259528 | - | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
QG930_RS06005 (QG930_06005) | 1259555..1259929 | - | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
QG930_RS06010 (QG930_06010) | 1260415..1263561 | - | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
QG930_RS06015 (QG930_06015) | 1263584..1264777 | - | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T279334 WP_002892050.1 NZ_CP124220:c1259528-1259310 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT279334 WP_002892066.1 NZ_CP124220:c1259929-1259555 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |