Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 612940..613643 | Replicon | chromosome |
Accession | NZ_CP124220 | ||
Organism | Klebsiella pneumoniae strain Z |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | QG930_RS02895 | Protein ID | WP_017880111.1 |
Coordinates | 613302..613643 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | QG930_RS02890 | Protein ID | WP_050131139.1 |
Coordinates | 612940..613281 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QG930_RS02855 (QG930_02855) | 608090..608965 | + | 876 | WP_017880120.1 | GTPase family protein | - |
QG930_RS02860 (QG930_02860) | 609209..609925 | + | 717 | WP_032417794.1 | WYL domain-containing protein | - |
QG930_RS02865 (QG930_02865) | 609961..610413 | + | 453 | WP_031280325.1 | hypothetical protein | - |
QG930_RS02870 (QG930_02870) | 610485..610958 | + | 474 | WP_031280324.1 | hypothetical protein | - |
QG930_RS02875 (QG930_02875) | 611079..611900 | + | 822 | WP_017880115.1 | DUF932 domain-containing protein | - |
QG930_RS02880 (QG930_02880) | 611931..612374 | + | 444 | WP_017880114.1 | antirestriction protein | - |
QG930_RS02885 (QG930_02885) | 612387..612929 | + | 543 | WP_017880113.1 | DNA repair protein RadC | - |
QG930_RS02890 (QG930_02890) | 612940..613281 | + | 342 | WP_050131139.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QG930_RS02895 (QG930_02895) | 613302..613643 | + | 342 | WP_017880111.1 | TA system toxin CbtA family protein | Toxin |
QG930_RS02900 (QG930_02900) | 613907..614914 | + | 1008 | WP_017880110.1 | restriction endonuclease | - |
QG930_RS02905 (QG930_02905) | 615289..615399 | + | 111 | Protein_547 | DUF4102 domain-containing protein | - |
QG930_RS02910 (QG930_02910) | 615412..615546 | - | 135 | Protein_548 | transposase | - |
QG930_RS02915 (QG930_02915) | 615692..615955 | - | 264 | WP_004192273.1 | hypothetical protein | - |
QG930_RS02920 (QG930_02920) | 615945..617072 | - | 1128 | WP_023325431.1 | PAAR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 578559..618825 | 40266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12811.73 Da Isoelectric Point: 8.4941
>T279332 WP_017880111.1 NZ_CP124220:613302-613643 [Klebsiella pneumoniae]
MKTLPATNPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDIMRARQATGLLKRNRISAAR
MKTLPATNPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDIMRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|