Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 518996..519512 | Replicon | chromosome |
Accession | NZ_CP124220 | ||
Organism | Klebsiella pneumoniae strain Z |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A483NZA3 |
Locus tag | QG930_RS02470 | Protein ID | WP_004894697.1 |
Coordinates | 519228..519512 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | QG930_RS02465 | Protein ID | WP_002886901.1 |
Coordinates | 518996..519238 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QG930_RS02450 (QG930_02450) | 515024..515764 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
QG930_RS02455 (QG930_02455) | 515831..516985 | + | 1155 | WP_004178372.1 | lactonase family protein | - |
QG930_RS02460 (QG930_02460) | 517008..518918 | + | 1911 | WP_281471315.1 | PRD domain-containing protein | - |
QG930_RS02465 (QG930_02465) | 518996..519238 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QG930_RS02470 (QG930_02470) | 519228..519512 | + | 285 | WP_004894697.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QG930_RS02475 (QG930_02475) | 519516..519980 | - | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QG930_RS02480 (QG930_02480) | 520309..522447 | - | 2139 | WP_023325427.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QG930_RS02485 (QG930_02485) | 522805..523548 | - | 744 | WP_004894691.1 | MurR/RpiR family transcriptional regulator | - |
QG930_RS02490 (QG930_02490) | 523551..523724 | - | 174 | WP_002886906.1 | hypothetical protein | - |
QG930_RS02495 (QG930_02495) | 523854..524117 | + | 264 | WP_031280360.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11174.05 Da Isoelectric Point: 10.3787
>T279330 WP_004894697.1 NZ_CP124220:519228-519512 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIMQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIMQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483NZA3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |