Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/FR47-DUF1778 |
Location | 39475..40272 | Replicon | plasmid unnamed2 |
Accession | NZ_CP124123 | ||
Organism | Enterobacter hormaechei strain 2020CK-00198 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | F5S3R9 |
Locus tag | QIW35_RS23550 | Protein ID | WP_006812498.1 |
Coordinates | 39748..40272 (+) | Length | 175 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | F5S3R8 |
Locus tag | QIW35_RS23545 | Protein ID | WP_006812497.1 |
Coordinates | 39475..39744 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QIW35_RS23520 (QIW35_23520) | 34848..36188 | - | 1341 | WP_006812582.1 | DnaB-like helicase C-terminal domain-containing protein | - |
QIW35_RS23525 (QIW35_23525) | 36249..36974 | - | 726 | WP_006812583.1 | hypothetical protein | - |
QIW35_RS23530 (QIW35_23530) | 37238..38035 | + | 798 | WP_006812584.1 | DUF2971 domain-containing protein | - |
QIW35_RS23535 (QIW35_23535) | 38077..38430 | - | 354 | WP_160859104.1 | hypothetical protein | - |
QIW35_RS23540 (QIW35_23540) | 38436..39101 | - | 666 | WP_023315962.1 | AAA family ATPase | - |
QIW35_RS23545 (QIW35_23545) | 39475..39744 | + | 270 | WP_006812497.1 | DUF1778 domain-containing protein | Antitoxin |
QIW35_RS23550 (QIW35_23550) | 39748..40272 | + | 525 | WP_006812498.1 | GNAT family N-acetyltransferase | Toxin |
QIW35_RS23555 (QIW35_23555) | 40299..40463 | - | 165 | WP_006812499.1 | hypothetical protein | - |
QIW35_RS23560 (QIW35_23560) | 40456..40707 | - | 252 | WP_000147960.1 | hypothetical protein | - |
QIW35_RS23565 (QIW35_23565) | 40709..41401 | - | 693 | WP_006812500.1 | membrane protein | - |
QIW35_RS23570 (QIW35_23570) | 41415..41738 | - | 324 | WP_000064173.1 | hypothetical protein | - |
QIW35_RS23575 (QIW35_23575) | 41813..42601 | - | 789 | WP_032655902.1 | receptor-recognizing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..113075 | 113075 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19356.13 Da Isoelectric Point: 8.9844
>T279327 WP_006812498.1 NZ_CP124123:39748-40272 [Enterobacter hormaechei]
VANLTIEMFSEEAVYDFSCFDCGETSLNDFLNNRLAQQHSGRILRGYLLLTRDPIPKVMGFYTLSGSCFARNTLPSNTQQ
RKVPYSDAPSVTLGRLAIDKSIQRQGYGETLVAHAMKVVYRASLAVGIYALFVDAKNENAMRFYKQLGFTPLTGDNANSL
FYPTKGIEKLFGGK
VANLTIEMFSEEAVYDFSCFDCGETSLNDFLNNRLAQQHSGRILRGYLLLTRDPIPKVMGFYTLSGSCFARNTLPSNTQQ
RKVPYSDAPSVTLGRLAIDKSIQRQGYGETLVAHAMKVVYRASLAVGIYALFVDAKNENAMRFYKQLGFTPLTGDNANSL
FYPTKGIEKLFGGK
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J0QWY8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J0QUA3 |