Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 74975..75618 Replicon plasmid unnamed1
Accession NZ_CP124122
Organism Enterobacter hormaechei strain 2020CK-00198

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag QIW35_RS22985 Protein ID WP_058672500.1
Coordinates 74975..75391 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag QIW35_RS22990 Protein ID WP_058672491.1
Coordinates 75388..75618 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QIW35_RS22960 (QIW35_22960) 70458..70796 - 339 WP_007374386.1 carboxymuconolactone decarboxylase family protein -
QIW35_RS22965 (QIW35_22965) 70813..71382 - 570 WP_045334638.1 TetR/AcrR family transcriptional regulator -
QIW35_RS22970 (QIW35_22970) 71566..72123 - 558 WP_007374384.1 OsmC family protein -
QIW35_RS22975 (QIW35_22975) 72332..73354 - 1023 WP_045334637.1 helicase UvrD -
QIW35_RS22980 (QIW35_22980) 73339..74901 - 1563 WP_045334636.1 AAA family ATPase -
QIW35_RS22985 (QIW35_22985) 74975..75391 - 417 WP_058672500.1 type II toxin-antitoxin system VapC family toxin Toxin
QIW35_RS22990 (QIW35_22990) 75388..75618 - 231 WP_058672491.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QIW35_RS22995 (QIW35_22995) 76005..76358 + 354 WP_269147465.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
QIW35_RS23000 (QIW35_23000) 76408..76770 + 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
QIW35_RS23005 (QIW35_23005) 76788..78539 + 1752 WP_045334630.1 arsenite efflux transporter ATPase subunit ArsA -
QIW35_RS23010 (QIW35_23010) 78587..79876 + 1290 WP_004152098.1 arsenite efflux transporter membrane subunit ArsB -
QIW35_RS23015 (QIW35_23015) 79889..80314 + 426 WP_045334628.1 glutaredoxin-dependent arsenate reductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..137276 137276


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15161.57 Da        Isoelectric Point: 7.2452

>T279326 WP_058672500.1 NZ_CP124122:c75391-74975 [Enterobacter hormaechei]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRD
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8650.75 Da        Isoelectric Point: 4.5881

>AT279326 WP_058672491.1 NZ_CP124122:c75618-75388 [Enterobacter hormaechei]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAERGDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References