Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 74975..75618 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP124122 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00198 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | QIW35_RS22985 | Protein ID | WP_058672500.1 |
| Coordinates | 74975..75391 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | QIW35_RS22990 | Protein ID | WP_058672491.1 |
| Coordinates | 75388..75618 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QIW35_RS22960 (QIW35_22960) | 70458..70796 | - | 339 | WP_007374386.1 | carboxymuconolactone decarboxylase family protein | - |
| QIW35_RS22965 (QIW35_22965) | 70813..71382 | - | 570 | WP_045334638.1 | TetR/AcrR family transcriptional regulator | - |
| QIW35_RS22970 (QIW35_22970) | 71566..72123 | - | 558 | WP_007374384.1 | OsmC family protein | - |
| QIW35_RS22975 (QIW35_22975) | 72332..73354 | - | 1023 | WP_045334637.1 | helicase UvrD | - |
| QIW35_RS22980 (QIW35_22980) | 73339..74901 | - | 1563 | WP_045334636.1 | AAA family ATPase | - |
| QIW35_RS22985 (QIW35_22985) | 74975..75391 | - | 417 | WP_058672500.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QIW35_RS22990 (QIW35_22990) | 75388..75618 | - | 231 | WP_058672491.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QIW35_RS22995 (QIW35_22995) | 76005..76358 | + | 354 | WP_269147465.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| QIW35_RS23000 (QIW35_23000) | 76408..76770 | + | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
| QIW35_RS23005 (QIW35_23005) | 76788..78539 | + | 1752 | WP_045334630.1 | arsenite efflux transporter ATPase subunit ArsA | - |
| QIW35_RS23010 (QIW35_23010) | 78587..79876 | + | 1290 | WP_004152098.1 | arsenite efflux transporter membrane subunit ArsB | - |
| QIW35_RS23015 (QIW35_23015) | 79889..80314 | + | 426 | WP_045334628.1 | glutaredoxin-dependent arsenate reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..137276 | 137276 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15161.57 Da Isoelectric Point: 7.2452
>T279326 WP_058672500.1 NZ_CP124122:c75391-74975 [Enterobacter hormaechei]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRD
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRD
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|