Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
Location | 47057..47796 | Replicon | plasmid unnamed1 |
Accession | NZ_CP124122 | ||
Organism | Enterobacter hormaechei strain 2020CK-00198 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | QIW35_RS22825 | Protein ID | WP_045334714.1 |
Coordinates | 47057..47542 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | QIW35_RS22830 | Protein ID | WP_045334712.1 |
Coordinates | 47530..47796 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QIW35_RS22810 (QIW35_22810) | 43595..44035 | + | 441 | WP_058672231.1 | hypothetical protein | - |
QIW35_RS22815 (QIW35_22815) | 44038..45192 | + | 1155 | WP_058672230.1 | hypothetical protein | - |
QIW35_RS22820 (QIW35_22820) | 45468..46870 | - | 1403 | Protein_47 | ISNCY family transposase | - |
QIW35_RS22825 (QIW35_22825) | 47057..47542 | - | 486 | WP_045334714.1 | GNAT family N-acetyltransferase | Toxin |
QIW35_RS22830 (QIW35_22830) | 47530..47796 | - | 267 | WP_045334712.1 | DUF1778 domain-containing protein | Antitoxin |
QIW35_RS22835 (QIW35_22835) | 48433..49446 | + | 1014 | WP_045334710.1 | plasmid replication initiator RepA | - |
QIW35_RS22840 (QIW35_22840) | 50397..51203 | + | 807 | WP_045334708.1 | DUF4225 domain-containing protein | - |
QIW35_RS22845 (QIW35_22845) | 51178..51507 | - | 330 | WP_045334705.1 | hypothetical protein | - |
QIW35_RS22850 (QIW35_22850) | 51590..51928 | - | 339 | WP_045334702.1 | hypothetical protein | - |
QIW35_RS22855 (QIW35_22855) | 51943..52713 | - | 771 | WP_045334699.1 | TraX family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..137276 | 137276 | |
- | flank | IS/Tn | - | - | 45468..46160 | 692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17607.36 Da Isoelectric Point: 10.1390
>T279325 WP_045334714.1 NZ_CP124122:c47542-47057 [Enterobacter hormaechei]
VGRVTAPEPLTSSHQLTEFVSGEAVLDDWLKQRGLKNQALGSARTFVVCKTGTKQVVGFYSLATGSVNHVEATGNIRRNM
PDPIPVIILARLAVDVSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEVAKSFYLHHGFKASQTQERTLFLKLP
Q
VGRVTAPEPLTSSHQLTEFVSGEAVLDDWLKQRGLKNQALGSARTFVVCKTGTKQVVGFYSLATGSVNHVEATGNIRRNM
PDPIPVIILARLAVDVSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEVAKSFYLHHGFKASQTQERTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|