Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 4652876..4653492 | Replicon | chromosome |
Accession | NZ_CP124121 | ||
Organism | Enterobacter hormaechei strain 2020CK-00198 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QIW35_RS22195 | Protein ID | WP_015569913.1 |
Coordinates | 4652876..4653247 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
Locus tag | QIW35_RS22200 | Protein ID | WP_015569912.1 |
Coordinates | 4653250..4653492 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QIW35_RS22180 (QIW35_22180) | 4650376..4651278 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
QIW35_RS22185 (QIW35_22185) | 4651275..4651910 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
QIW35_RS22190 (QIW35_22190) | 4651907..4652836 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
QIW35_RS22195 (QIW35_22195) | 4652876..4653247 | - | 372 | WP_015569913.1 | PIN domain-containing protein | Toxin |
QIW35_RS22200 (QIW35_22200) | 4653250..4653492 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
QIW35_RS22205 (QIW35_22205) | 4653691..4654611 | + | 921 | WP_015569911.1 | alpha/beta hydrolase | - |
QIW35_RS22210 (QIW35_22210) | 4654620..4655561 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
QIW35_RS22215 (QIW35_22215) | 4655606..4656043 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
QIW35_RS22220 (QIW35_22220) | 4656040..4656921 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
QIW35_RS22225 (QIW35_22225) | 4656915..4657514 | - | 600 | WP_017694048.1 | glucose-1-phosphatase | - |
QIW35_RS22230 (QIW35_22230) | 4657633..4658433 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13767.90 Da Isoelectric Point: 6.4882
>T279324 WP_015569913.1 NZ_CP124121:c4653247-4652876 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|