Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3789671..3790328 | Replicon | chromosome |
Accession | NZ_CP124121 | ||
Organism | Enterobacter hormaechei strain 2020CK-00198 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A7T9SH06 |
Locus tag | QIW35_RS17995 | Protein ID | WP_023295382.1 |
Coordinates | 3789671..3790081 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | QIW35_RS18000 | Protein ID | WP_003863437.1 |
Coordinates | 3790062..3790328 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QIW35_RS17975 (QIW35_17975) | 3785669..3787402 | - | 1734 | WP_017382886.1 | single-stranded-DNA-specific exonuclease RecJ | - |
QIW35_RS17980 (QIW35_17980) | 3787408..3788121 | - | 714 | WP_015571792.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QIW35_RS17985 (QIW35_17985) | 3788150..3789046 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
QIW35_RS17990 (QIW35_17990) | 3789148..3789669 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
QIW35_RS17995 (QIW35_17995) | 3789671..3790081 | - | 411 | WP_023295382.1 | protein YgfX | Toxin |
QIW35_RS18000 (QIW35_18000) | 3790062..3790328 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
QIW35_RS18005 (QIW35_18005) | 3790623..3791603 | + | 981 | WP_039269839.1 | tRNA-modifying protein YgfZ | - |
QIW35_RS18010 (QIW35_18010) | 3791715..3792374 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
QIW35_RS18015 (QIW35_18015) | 3792641..3793369 | + | 729 | WP_039269836.1 | MurR/RpiR family transcriptional regulator | - |
QIW35_RS18020 (QIW35_18020) | 3793489..3794922 | + | 1434 | WP_017382891.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16291.18 Da Isoelectric Point: 11.4775
>T279323 WP_023295382.1 NZ_CP124121:c3790081-3789671 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGAPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGAPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7T9SH06 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837F8P5 |