Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2307824..2308563 | Replicon | chromosome |
| Accession | NZ_CP124121 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00198 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A3L9PBP9 |
| Locus tag | QIW35_RS11035 | Protein ID | WP_003857133.1 |
| Coordinates | 2307824..2308309 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | QIW35_RS11040 | Protein ID | WP_003857131.1 |
| Coordinates | 2308297..2308563 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QIW35_RS11010 (QIW35_11010) | 2303368..2304126 | - | 759 | WP_017693420.1 | trans-aconitate 2-methyltransferase | - |
| QIW35_RS11015 (QIW35_11015) | 2304211..2304795 | - | 585 | WP_039270753.1 | NUDIX domain-containing protein | - |
| QIW35_RS11020 (QIW35_11020) | 2304882..2305640 | + | 759 | WP_015570520.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| QIW35_RS11025 (QIW35_11025) | 2305745..2307037 | + | 1293 | WP_032648327.1 | glycosyl hydrolase family 28 protein | - |
| QIW35_RS11030 (QIW35_11030) | 2307037..2307651 | + | 615 | WP_080338042.1 | NUDIX hydrolase | - |
| QIW35_RS11035 (QIW35_11035) | 2307824..2308309 | - | 486 | WP_003857133.1 | GNAT family N-acetyltransferase | Toxin |
| QIW35_RS11040 (QIW35_11040) | 2308297..2308563 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| QIW35_RS11045 (QIW35_11045) | 2308627..2309556 | - | 930 | WP_039270752.1 | LysR family transcriptional regulator | - |
| QIW35_RS11050 (QIW35_11050) | 2309686..2311068 | + | 1383 | WP_039270751.1 | MFS transporter | - |
| QIW35_RS11055 (QIW35_11055) | 2311090..2312085 | - | 996 | WP_271039689.1 | DUF2891 domain-containing protein | - |
| QIW35_RS11060 (QIW35_11060) | 2312095..2313081 | - | 987 | WP_023296632.1 | DUF979 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2294460..2308563 | 14103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T279317 WP_003857133.1 NZ_CP124121:c2308309-2307824 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3L9PBP9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FCR9 |