Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1102650..1103270 | Replicon | chromosome |
Accession | NZ_CP124121 | ||
Organism | Enterobacter hormaechei strain 2020CK-00198 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A837FFM2 |
Locus tag | QIW35_RS05175 | Protein ID | WP_015571250.1 |
Coordinates | 1102650..1102868 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | F5RUW7 |
Locus tag | QIW35_RS05180 | Protein ID | WP_006809850.1 |
Coordinates | 1102896..1103270 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QIW35_RS05145 (QIW35_05145) | 1098662..1098922 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
QIW35_RS05150 (QIW35_05150) | 1098925..1099065 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
QIW35_RS05155 (QIW35_05155) | 1099062..1099772 | - | 711 | WP_032670463.1 | GNAT family protein | - |
QIW35_RS05160 (QIW35_05160) | 1099874..1101334 | + | 1461 | WP_039271537.1 | PLP-dependent aminotransferase family protein | - |
QIW35_RS05165 (QIW35_05165) | 1101306..1101773 | - | 468 | WP_023296041.1 | YlaC family protein | - |
QIW35_RS05170 (QIW35_05170) | 1101890..1102441 | - | 552 | WP_015571251.1 | maltose O-acetyltransferase | - |
QIW35_RS05175 (QIW35_05175) | 1102650..1102868 | - | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
QIW35_RS05180 (QIW35_05180) | 1102896..1103270 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
QIW35_RS05185 (QIW35_05185) | 1103781..1106927 | - | 3147 | WP_015571248.1 | multidrug efflux RND transporter permease subunit AcrB | - |
QIW35_RS05190 (QIW35_05190) | 1106950..1108143 | - | 1194 | WP_017694395.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T279316 WP_015571250.1 NZ_CP124121:c1102868-1102650 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT279316 WP_006809850.1 NZ_CP124121:c1103270-1102896 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FFM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FGN8 |